Como Reagir Quando Alguem Nos Ofende?

Como Reagir Quando Alguem Nos Ofende?

Texto de Jennifer Delgado Sêneca disse que, um dia, enquanto Cato visitava os banheiros públicos, ele foi empurrado e espancado. Quando eles interromperam a luta, ele se recusou a aceitar um pedido de desculpas do agressor dizendo: “Eu nem lembro de ter sido atingido “.

Embora seu comportamento possa parecer estranho para nós, Cato simplesmente decidiu não se apegar ao que aconteceu. Ele não ficou preso em humilhação, frustração ou raiva, mas rapidamente virou a página.

Ele escolheu agir em vez de apenas reagir. Ele escolheu recuperar o controle da situação e responder de forma mais madura.

Ele escolheu ser fiel aos princípios do estoicismo, que nos ensinam como responder a um insulto de forma inteligente.

Insultos desencadeiam uma intensa resposta emocional Todos, em maior ou menor grau, já provaram o gosto amargo dos insultos. Não é agradável. Não há dúvida.

Mas responder com raiva, frustração ou mesmo agressividade é tão inútil quanto tomar veneno esperando para prejudicar outra pessoa.

Quando palavras tolas vibram ao nosso redor, precisamos aprender a dar respostas inteligentes a insultos, a nosso próprio bem-estar psicológico.

O principal obstáculo, no entanto, é o nosso cérebro emocional. Quando ouvimos um insulto, geralmente reagimos automaticamente, tornando-nos defensivos. Ficamos com raiva e estressados, por isso não devemos apenas lidar com o insulto, mas também com as emoções desagradáveis ​​que ele gerou.

Para parar este mecanismo, devemos entender que o cérebro emocional não funciona racionalmente. Preencha os espaços em branco e corra para tirar conclusões, independentemente de a crítica ser válida.

Para responder a um insulto de forma inteligente, precisamos evitar um seqüestro emocional. Em vez de deixar as emoções assumirem, temos que ativar nosso pensamento lógico, concentrando-nos nos fatos.

O sequestro emocional ocorre quando nós consideramos que o insulto como um ataque ao nosso ego. Então a amígdala reage como se estivéssemos em perigo e parasse de se comportar racionalmente.

Em vez disso, precisamos estar cientes de que a linha entre um insulto e uma crítica construtiva pode se tornar muito boa e subjetiva.

De fato, Epícteto pensava que o insulto não é a pessoa, seus atos ou palavras, mas nosso julgamento sobre o que aconteceu. É uma coisa difícil de digerir, mas, para sermos insultados, devemos permitir que esse insulto se estabeleça em nós. Este filósofo acrescentou: ” Ninguém pode prejudicá-lo sem o seu consentimento, você será ferido no momento em que lhe permitir prejudicá-lo “.

As 3 telas dos estóicos para avaliar os insultos Os estóicos sugeriram que antes de responder a um insulto, passemos por essas três peneiras:

Veracidade Se nos sentimos insultados, Seneca sugere que paremos por um momento para considerar se as palavras são verdadeiras. Se alguém está se referindo a uma de nossas características, por exemplo, não é um insulto, independentemente do tom usado, é apenas um ponto óbvio.

Se não queremos que isso aconteça novamente, talvez devêssemos fazer algo para mudar essa característica, ou apenas aceitá-la, para que ela não se torne um ponto sensível que nos faça pular toda vez que alguém a tocar.

Nível de informação O próximo passo que devemos dar para responder a um insulto de maneira inteligente vem da mão de Epíceto, que nos recomenda avaliar se nosso interlocutor está pelo menos bem informado.

Se for uma pessoa informada, devemos valorizar o que ele está dizendo, mesmo que a princípio nos cause rejeição ou não caia em nossa cosmovisão. Talvez ele esteja certo. Se você não é uma pessoa informada, mas está falando da ignorância, nós simplesmente não devemos levar em conta sua opinião ou ficar com raiva disso.

Autoridade A última tela pela qual devemos passar um “insulto” é avaliar sua origem. Se estamos aprendendo a tocar piano e o suposto “insulto” vem do nosso mestre de piano, talvez seja uma crítica construtiva que devemos ouvir, em vez de ficar com raiva. Seja melhor do que quem te insulta

Marco Aurélio, proeminente imperador romano e estóico, pensava que não deveríamos conceder àqueles que nos insultam a possibilidade de manipular nossas emoções. Ele escreveu: ” A melhor vingança não é ser como aquele que machucou você “.

Sêneca, por outro lado, pensava que a raiva sempre dura mais do que a dor, por isso não faz sentido ficar com raiva de um insulto. Não devemos permitir que esse insulto arruine nosso dia ou dê mais importância do que merece.

Ele escreveu: “ Uma grande mente despreza as queixas feitas a ela; A maior forma de desdém é considerar que o adversário não é digno de vingança. Quando se vingam, muitos levam muito a sério pequenas humilhações.

Uma grande e nobre pessoa é aquela que, como um grande animal selvagem, escuta impassível as pequenas maldições que lhe são lançadas ”. Ignorar o insulto de alguém é a maneira mais poderosa de reagir porque demonstra autocontrole e nos impede de cair no jogo.

A chave é levar um momento antes de reagir. Respire, pense e depois decida o que fazer.

Quando aumentamos o tempo entre o estímulo / insulto e nossa reação, podemos dar uma resposta mais reflexiva. Podemos recorrer à lógica e ir além da emoção inicial. Os estóicos não tinham nada contra as emoções, mas se é uma emoção indesejada que pode causar danos, é melhor deixá-la seguir seu curso e não segurá-la.

Epicteto compartilhou essa ideia. Ele se perguntou: “ Quem é invencível? Aquele que não pode ser perturbado por outra coisa senão sua decisão fundamentada .

Isso significa que, se nos atacarem, não devemos nos defender? Claro que não. Mas se os estóicos tivessem a oportunidade de escolher, prefeririam que a paz fosse correta. Levantar-se acima dos insultos é uma postura mais madura que lhe permitirá proteger sua paz interior . Afinal, não faz muito sentido discutir com um tolo .

Olhando para o positivo no insulto Podemos até procurar o positivo em insultos.

Podemos deixar de lado a grosseria e a maldade para procurar por pepitas de ouro que possam estar escondidas em críticas ácidas. Podemos usar esses comentários para melhorar.

De fato, os estóicos costumavam ver o insulto de um amigo ou mentor de confiança como um favor pessoal, uma oportunidade de superação que deveria ser recebida com gratidão.

Toda vez que alguém nos insulta e conseguimos nos controlar, é uma vitória pessoal.

Responder a um insulto com outro insulto, ao contrário, implica reproduzir a cadeia de raiva, imaturidade ou estupidez humana. Isso não vai mudar as coisas.

Se reagirmos com calma e até mesmo com gratidão, levaremos a pessoa que nos insultou de surpresa, de modo que é mais provável que reflitamos sobre seu comportamento.

Para nos controlarmos e insultos não nos afetam, devemos trabalhar para reduzir a sensibilidade às nossas próprias imperfeições, adotando a idéia de que temos falhas e fraquezas e que, às vezes, as pessoas as apontam.

Nós não somos perfeitos e temos que assumir isso. Se aprendermos a acalmar o ego , os insultos passarão sem nos tocar.

Seria muito pior viver em uma espécie de mundo de sonhos onde todos fingem que não temos defeitos, para que não tivéssemos a possibilidade de mudar e crescer.

  • Texto de , Ricón de la Psicología, adaptado pela Revista Pazes.

Tenhamos serenidade diante das críticas e ofensas

Um dos grandes segredos para sermos felizes é sabermos enfrentar os problemas com maturidade e serenidade. Se quisermos ser felizes, não deixemos que nada de negativo invada nosso coração.

Procuremos viver reagindo com naturalidade. É claro que vamos nos sentir magoados quando alguém nos ofender, mas, como já sabemos, é preciso ter serenidade e maturidade diante das críticas e ofensas.

Infelizmente, a maioria das pessoas acha que precisa ter sempre razão acerca de tudo. E isso também tira-lhes a paz interior, pois se sentem forçadas a argumentar até as últimas consequências. Aí está a causa de tantas brigas, discussões e contendas.

Não precisamos ter sempre a última palavra. O outro também pode ter razão; talvez estejamos enganados. Talvez o outro precise de um reforço positivo, talvez também tenha necessidade de se superar.

São argumentos que nos ajudam a não perdermos a paz com discussões idiotas.

Como Reagir Quando Alguem Nos Ofende?

Foto: OSTILL by Getty Images

O que a Bíblica nos ensina?

A Bíblia nos diz que Jesus não discutia nunca. Ele simplesmente respondia, ocultava-se de Seus adversários ou se retirava. Em meio a uma discussão que não levaria a nada, “ocultou-se deles” (cf. Jo 12,36).

Jesus sabia quem era, a verdade que possuía e a importância de Sua missão. Por isso mesmo, ao ser uma vez agredido, “passando por eles, retirou-se” (cf. Lc 4,30). Ele nunca contestava.

Jamais precisou argumentar: “Só saio daqui quando provar que sou o Filho de Deus”. Ele sabia que o era.

Essa é uma das grandes ações que podemos e devemos experimentar. Tenho procurado realizar isso em minha vida e tenho percebido, cada vez mais, que os frutos são muito positivos.

Por que vou perder tempo tentando me defender? Ora, quando uma pessoa nos acusa, ela o faz por motivos interiores. Ou a estamos incomodando ou questionando algum comportamento seu com nossa atitude. Então, ela passa para a defensiva e procura nos provocar.

Tristes daqueles que aceitam a provocação. Acabam se igualando na provocação.

Leia mais:
.: Respeitar a escolha do outro com serenidade
.: O valor e a importância da tolerância no cotidiano
.: Será que sou uma pessoa contestadora?
.: Socialização, os sintomas da maturidade

Tenha um coração curado

Para manter a paz interior, é preciso muito mais que algumas pistas psicológicas. É preciso ter o coração curado. A cura interior nos revela quem somos, mostra-nos que não precisamos provar nada a ninguém. Basta que saibamos, com humilde e serenidade, diante de Deus e de nós mesmos, quem somos de fato. A cura interior nos ajuda também a mudar o que em nós precisa ser mudado.

Trecho extraído do livro: “Seja feliz todos os dias”, padre Léo, SCJ


Ofensas, xingamentos e críticas: como lidar?

Olá amigos!

De tempos em tempos acontece de eu receber dúvidas e emails ligados ao mesmo tema. Nestes últimos dias tenho recebido perguntas que se referem a ofensas, xingamentos e críticas. Em resumo, como lidar com pessoas que são difíceis de conviver por sempre apresentar este tipo de comportamento?

Leia também:  Paises Que Reconhecem Jerusalem Como Capital De Israel?

Bem, evidentemente não existe uma resposta única para esta pergunta. Isto porque podemos até aprender a lidar melhor, de modo a não nos afetarmos (ou pelo menos não nos afetarmos tanto), mas, também não devemos ser ingênuos e aceitar passivamente. Em outras palavras, às vezes deixar de conviver – se possível – acaba sendo a estratégia mais adequada.

Palavras como sons vazios

Na filosofia existe a ideia de que as palavras seriam flatus vocis, vozes vazias, sons vazios. Se alguém te chama de um nome ofensivo ela está usando uma palavra para ofender. Como conhecemos português e, portanto, como o sentido atribuído àquele som foi aprendido, podemos nos ofender.

Agora, se alguém diz – Donaudampfschifffahrtsgesellschaftskapitaenswitwe – e você não sabe alemão, você se ofenderia? Provavelmente não, porque você não saberia o sentido daquela palavra e entender que a linguagem com seus sons é, em última instância, sons sem sentido nos ajuda a criar distanciamento.

Assim como uma palavra estrangeira não vai trazer nenhum sentimento negativo, uma palavra em português pode também ter o mesmo efeito. Porque uma palavra depreciativa ou agressiva, ao contrário do que dizem, não é como dar um soco, um murro, uma facada, um tiro.

Porque nestes casos há uma agressão do contato, enquanto que nas palavras existe uma relação muito mais subjetiva. Como aprendemos em redação, em uma comunicação temos o emissor e o receptor.

E, embora o emissor tenho o poder de dizer isto ou aquilo, há um meio (que é a língua, no nosso caso, o português) e do outro lado há o receptor, quem está recebendo a mensagem ou para quem ela está sendo dirigida (o destinatário em um email ou carta, o ouvinte em uma fala, etc).

O X da questão é que não podemos – como ouvintes, como receptores – controlar o comportamento do emissor. Se eu estou ouvindo, não tem como eu querer que a pessoa fale do jeito que eu quero que ela fale. Se pararmos para pensar, veremos que é quase que uma loucura querer que a pessoa fale conforme nós falamos.

E, se embora não possamos controlar o que é dito, podemos sim controlar o modo como a mensagem é captada e recebida. Por exemplo, se eu peço uma informação quando estou em uma cidade desconhecida e a pessoa não me responde ou me responde sem nenhuma educação, o problema é dela. Eu não posso controlar o comportamento verbal dela.

Porém, a forma como eu vou reagir está sob o meu controle. Apesar de que reagimos quase que instantaneamente, existe um espaço de tempo – sempre existe! – para decidir se vamos agir também com grosseria, se vamos silenciar ou se vamos embora ou dar um abraço. Enfim, o que está sob o nosso controle é a forma como reagimos.

Quando alguém diz que uma ofensa é como uma facada, ela está dizendo uma metáfora. Como vimos, a fala é tão somente a emissão de um som por um aparelho fonador.

Porém, como é impossível não entender uma língua depois que você a aprendeu, o som se transforma em sentido e o sentido é vivenciado como uma sensação corporal. E a sensação corporal, por sua vez, é sentida como agradável ou desagradável.

No fim, quando reagimos, não estamos mais reagindo ao som mas sim à sensação corporal que é acima de tudo uma sensação temporária.

Alguém diz: “Você é burro” (um som)

Este som é ouvido. Se houvesse um ruído muito alto não seria e o processo seria interrompido. Mas se é ouvido, o som se transforma em uma informação mental. Burro. Burrice. Isto é uma ofensa. E, em questão de segundos, esta informação é vivenciada diretamente em sensação físicas: palpitação ou taquicardia ou náusea ou irritação ou desconforto aqui ou ali.

Segundos depois, a sensação é etiquetada como uma sensação desagradável. E, muito rapidamente, há a opção instintiva de lutar ou fugir. Lutar significa brigar, gritar, responder, querer agredir… e fugir significa correr, sair dali, passar mal e desmaiar, etc…

Som, sentido, sensação… tudo isso é muito transitório. Como surge em um momento, no momento seguinte não existe mais. Entretanto, como é típico, as pessoas tendem a reviver suas experiências.

E se alguém disse “você é burro” e este dizer durou três segundos e acabou, quem ouviu consegue levar – se quiser ou sem perceber – estes três segundos como uma gravação a ser repetida centenas e centenas de vezes. E para quê?

O que foi dito, já foi dito. E é um problema e uma responsabilidade de quem disse. Não podemos controlar o dizer alheio. Mas podemos entender o processo como um todo e compreender que temos o poder de responder de um jeito ou de outro.

É como um apelido. Em uma sala de aula, um grupinho inventa um apelido para o gordinho da sala: baleia, Free Willy, bola. Se o gordinho não liga, o apelido não pega. Mas basta ficar irritado que o apelido cola por anos…talvez até pela vida toda…

Claro que em um mundo ideal as pessoas seriam mais amorosas e não fariam este tipo de brincadeira caso soubessem como isto marca. Porém, cada um de nós também tem o poder de aprender a reagir e a reagir melhor às palavras que ouvimos.

Ou seja, é necessário aprender que o poder da comunicação não está no emissor e sim no receptor. É na recepção que o sentido será sentido e vivenciado. Se não fosse assim, seríamos meros robôs a reagir conforme um comando externo.

Mas sei que é um longo processo para passar a entender de verdade o que aqui foi dito. Podemos aprender com uma série de técnicas que vão da meditação à psicoterapia ou análise.

A vantagem é que somos testados com uma frequência que não gostaríamos e, portanto, temos bastante chance para aprender que as palavras são sons e que reagimos às sensações corporais.

Entre o som, entre o sentido, entre a sensação e entre a reação existem espaços de escolha.


 Tudo isso não significa ter passividade e aceitar tudo. Em alguns casos é preciso tomar medidas judiciais por dano moral, calúnia, difamação. Mas no dia a dia, nas relações com conhecidos, familiares ou amigos, temos muitas chances de reagir com mais amorosidade ao sofrimento do outro. Afinal, ninguém ofenderia, xingaria ou gritaria se não estivesse sofrendo.

10 Maneiras de não se deixar afetar por ofensas

Nem sempre tudo acontece como queremos. Diariamente precisamos encarar ofensas e situações que fogem do nosso controle.

Como resultado, perdemos o controle sobre as nossas vidas e nos deixamos dominar pelos nossos próprios pensamentos.

Mas por que não lidar com essas situações de uma outra maneira? Por que não parar de se sentir ofendido e simplesmente começar a viver? Por que não encarar uma ofensa com um pouco de bom humor?

Confira as dicas que trazemos hoje e vença os sentimentos negativos que nos cercam todos os dias.

Inconscientemente, as pessoas acham que os outros sempre devem algo a elas. Esperamos que o mundo nos entenda, nos aprove e nos dê presentes. Quando isso não acontece, nos ofendemos.

Isso não está certo: ninguém nos deve nada. Em geral, inventamos um mundo ideal e ficamos irritados com a realidade porque nem tudo sai como o planejado.

Lembre-se de que nem todo mundo precisa realizar todos os nossos desejos. Desta forma, a vida será muito mais gostosa. Ficar feliz com os presentes inesperados é muito mais importante do que se ofender pela impossibilidade de obter algo desejado.

É muito comum as pessoas incluírem sentimentos em tudo, exagerarem e distorcerem as emoções. Vemos duplo sentido em brincadeiras e com frequência nos deixamos enganar pela nossa imaginação.

Tente olhar para os acontecimentos que te fazem mal com distanciamento. Procure olhar para eles de fora, baseando-se em fatos concretos. Muitas vezes, as coisas não acontecem para nos fazer mal.

Te disseram algo desagradável? Levantaram a voz? Te ofenderam? Traduza tudo isso mentalmente para uma linguagem normal. Algumas pessoas não sabem como expressar os pensamentos de maneiras diferentes, ou não conhecem outros idiomas. Tente não se ofender pelo que elas dizem.

As traduções mentais do 'ofensivo' para o neutro são boas para a sua saúde mental e te deixam mais relaxado e animado.

Levamos muito a sério as pessoas que falam mal de nós e nos fazem coisas desagradáveis. Nos ofendemos porque achamos que estamos sempre lidando com pessoas adultas e inteligentes, ou até mesmo superiores a nós. Será?

Tente pensar que seus abusadores são bobos e medíocres e que a opinião deles não tem importância. Procure pensar que essas pessoas são apenas crianças que querem chamar a sua atenção. Ao fazer isso, você vai perceber que elas são muito mais desimportantes do que você imagina. E você não se ofenderia com crianças, certo?

Exageramos o que o momento atual significa. Pensamos que as coisas que acontecem são para sempre, que a raiva jamais vai passar. Mas quantas vezes nos ofendemos e esquecemos? É impressionante como sofremos por coisas insignificantes.

Tente olhar para esse rancor no futuro. Provavelmente os sentimentos vão parecer sem sentido amanhã, e não vale a pena estressar-se tanto hoje se pensarmos no amanhã.

Com frequência, a pessoa que ofende está passando por um mal momento, ou está com problemas. Muitas vezes, fazer mal aos outros é parte disso. Tente entender a pessoa grosseira. Talvez ela precise de ajuda ou apoio. Você não vai se sentir tão incomodado por palavras desagradáveis se encontrar a razão da ira do seu ofensor.

Todos sofremos ofensas todos os dias. Cada um de nós precisa enfrentar situações desagradáveis e, como não podemos nos isolar completamente, deveríamos aprender a perceber o ressentimento como um componente desagradável e natural da comunicação humana.

Leia também:  Onde E Como Surgiu O Futebol?

Você pode simplesmente não reagir a comentários ofensivos. Perceba-os como o som de um passarinho histérico, ou como latidos de cães fora da janela. Ou seja, como irritantes, mas naturais. Em algum momento tudo isso passa.

Você não precisa enfrentar os insultos ou fingir que não percebeu a agressividade do outro. Às vezes, uma pergunta direta e tranquila ao agressor sobre as razões do seu comportamento ajuda a colocá-lo no seu devido lugar. É provável que ele não possa te responder, se sinta envergonhado e simplesmente saia de cena.

Muitas vezes, amigos e conhecidos com 'boas' intenções ultrapassam as nossas fronteiras com conselhos desagradáveis ou reflexões sem nenhum tato.

Mas os comentários ofensivos e as piadas sem graça nos atingem até onde permitimos. Muitas vezes, não vale a pena discutir com o seu ofensor. Uma alternativa é encarar a situação com humor e responder ironicamente para desarmar a outra pessoa.

Pense naquele pequeno insulto que não te deixa em paz e te faz pensar sem parar no que aconteceu. Você deixa todo restante da vida em pausa apenas por algo que outra pessoa te falou. E tudo não passa de uma ofensa sem sentido.

Converse com você mesmo. De que adianta se sentir ofendido? Isso resolve algum problema? Se você for um masoquista moral, então tudo bem. Mas por que levar tudo tão a sério? Tente se liberar do rancor e libere os sentimentos de agonia.

Você acha que essas dicas vão te ajudar a eliminar os pensamentos negativos e a encarar melhor as ofensas? Conhece outras maneiras de lidar com essas situações?

Ilustrador Alena Tsarkova exclusivo para Incrí

A maneira mais inteligente de se defender dos ataques verbais

  • Sheldon Cooper disse: “Eu sou um receptor polimerizado, e você um reagente inorgânico, então qualquer projétil verbal que você lançar na minha direção será refletido, voltará pela mesma trajetória, e irá te atingir.”
  • Tenha certeza disso: quando um ser humano ofende o outro com palavras de ódio e furor, ele atrai para si, um amontoado de negatividades que faz com que o universo inteiro se volte contra ele, ou seja, no fim, não é o receptor do ataque que sofre e sim o seu emissor (efeito boomerang).
  • Infelizmente algumas pessoas do nosso convívio são ignorantes, hostis e pouco educadas, o que torna nossa interação social um desafio constante e estressante por vários momentos em nossa vida, cabendo a nós, seres inteligentes, criar estratégias para lidar eficientemente com essa questão.

Vale mencionar que quando um troglodita age dessa forma, ele está demonstrando as duas maiores falhas emocionais do homem, a conhecer: à insegurança e o medo. A primeira existe porque ele não acredita que pode ter crédito com alguém através de uma postura equilibrada e ética, assim ele pensa que a força está na imposição e não na influência.

Já a segunda é por conta da psicose e do pânico por aquilo que ainda não chegou, ou seja, como se o futuro estivesse prestes a abraça-lo, enforcando sua aura e secando para sempre seu espírito, restando para ele, apenas a opção de reagir com agressividade.

Obviamente, atitudes como essas tem o poder de machucar muito uma pessoa, fazendo com que a mesma se sinta coagida e pressionada além do que pode suportar, principalmente se tal criatura gozar de um temperamento sensível e frágil.

Desta forma, é inaceitável que alguém insulte a outra parte e não sofra nenhuma punição por isso.

Em muitos casos e relatos contemplamos a multiplicidade de pessoas que foram prejudicadas por comportamentos assim e tiveram ferimentos gravíssimos em sua alma: tiveram sua psique triturada, sua motivação debulhada e sua autoestima esmagada.

Sabendo então da gravidade da questão, qual seria a estimada solução? Muitos pensam que rebater é uma forma inteligente de mostrar coragem e ausência de intimidação, porém afirmo com veemência que essa é uma escolha estúpida e ineficaz.

Ora, nos igualarmos aos nossos inimigos consiste em transferir a ignorância deles para dentro de nossas casas, fazendo com que nossos telhados sejam recheados de malignidades que farão com que as toxinas endiabradas do inferno permeiem nossas cabeças sem que possamos notar.

Por isso Dalai Lama brilhantemente disse: “Responder à ofensa com ofensa é como lavar a alma com lama! O silêncio é um dos argumentos mais difíceis de se rebater.”

Outros acham ainda, que adotar uma posição “tartaruguiana” é a resolução mais eficaz para desvendar o enigma. Assim, se omitem, abaixam a cabeça e permitem serem pisoteados, sem dó nem piedade.

Sob uma outra perspectiva, eles possuem medo de iniciar conflitos e de herdarem possíveis inimigos por conta de uma ação que pode impulsionar um ambiente turbulento e desagradável ocasionado por uma possível opinião mal vista ou de uma postura que pode não ser bem aceita pelo outro lado moeda.

Sem dúvidas, nenhuma dessas atitudes mudará o cenário caótico que fora criado por esses vampiros emocionais, haja vista que o segredo não é olvidar e tampouco copiar o adversário, mas sim criar uma terceira via, que é a síntese dessas duas e uma solução definitiva para o mistério em questão.

Com toda certeza, o que devemos fazer é provar para essas pessoas, através de nossas ações e exemplos que elas podem conseguir o que querem de uma forma muito mais fácil e rápida se fizerem exatamente o contrário (trocar a IRA pelo AMOR).

Em outros termos, o cerne da interrogação é influenciar esses néscios a pensarem de uma maneira mais lúcida e racional, gerando dentro deles uma essência nova que fará com que eles sejam seres humanos mais desenvolvidos e realizados.

Tentando ajudar meus semelhantes e procurando identificar os pontos mais importantes a serem tratados na presente variável, irei complementar os parágrafos expostos acima compartilhando 4 passos que julgo serem fundamentais para enfrentarmos e vencermos essa importante e desafiante esfera. Confira:

Saiba identificar as mentiras criadas por esses ignorantes

Primeiramente seu rival atacará o seu ego, tentando lhe convencer de que você veio ao mundo para ser um derrotado, pois tem defeitos e marcas incuráveis.

Por exemplo: ele tentará deixa-lo mais feio, menos competente e completamente inseguro através da propagação de falsas verdades.

Geralmente, isso acontece de forma ininterrupta, causando grandes complicações para a vítima que acaba acreditando nessas coisas que nem de longe correspondem a realidade.

  1. Neste caso, é preciso que tenhamos certeza de nosso potencial para envergonharmos tais criaturas, fazendo com que elas vejam a diferença de pensamento, de nível de entendimento e por consequência, parem de ostentar esse comportamento ridículo de querer crescer em cima dos outros.
  2. É preciso registrar que somente aceita ser escada dos outros quem não teve instrução ou oportunidade de pensar por si mesmo, haja vista que qualquer um que tiver o mínimo de lucidez saberá discernir entre o certo e o errado e entre um caráter moldado na rocha e um fabricado na areia.
  3. Se prepare para determinadas situações

Inicialmente, temos que compreender e aceitar que seremos humilhados em algum momento de nossa vida. É inevitável que algumas balas atinjam nosso corpo diante das pelejas existentes, daí a importância de estarmos sempre blindados e preparados para essas calamidades que certamente chegarão.

Desta forma, saber suportar esses ataques e humilhações, não deixando que eles nos afetem emocionalmente é uma das melhores maneiras de superar tal questão. Com o passar do tempo você verá que eles perderão força e sua mente herdará uma base sólida e gélida diante de tais negatividades.

Certamente, é necessário muito treino diante dessas situações constrangedoras, de modo que quanto mais “espetadas” levamos, mais robustos nos tornamos.

Em outros termos é como uma espécie de acúmulo de experiências ruins que com o tempo se tornam boas pela armadura que herdamos ao receber tais bordoadas.

Tenha autoestima elevada

Você foi gerado para ser um sucesso e tudo que gravite fora dessa instância é pura e absoluta tolice. Acredite, seu âmago é poderosamente sublime e nada nessa vida pode mudar ou sobrepujar isso.

O problema é que desde o seu nascimento até hoje, você foi bombardeado de críticas por ser cercado de pessoas que existem somente para rebaixá-lo e atirá-lo nas masmorras, de maneira cruel e fétida.

Automaticamente, ao crescer, seu subconsciente guardou essas falsas percepções e o transformou em uma criatura que acredita em tudo (Papai Noel, Coelhinho da Páscoa, Extraterrestre, etc…

) menos nas próprias potencialidades.

Pode parecer paranoia, mas o parágrafo acima é a maior verdade do universo, pois o homem moderno sabe muito sobre coisas e pouquíssimo sobre si mesmo. Basta olharmos as clínicas de psiquiatria e psicologia e veremos que ele vive rodando em círculos e constantemente precisa de ajuda para se reencontrar.

Portanto, o segredo é acreditar que tudo é possível se nos desenvolvermos e tivermos motivação para buscarmos nossos sonhos: sem titubear, estagnar e, principalmente, desanimar.

Se imponha com tenacidade e fibra

É importante também que saibamos de uma coisa: ás vezes é necessário nos impormos diante de alguns acontecimentos. Deste modo, em determinados momentos precisamos engrossar nosso tom de voz, adotando uma conduta mais firme para que essas pessoas se sintam pressionadas e parem de executar suas práticas idiotas, mostrando para elas que nosso rugido é imponente e digno de reações espaventas.

Além disso, precisamos demostrar para essas criaturas o quão pequenas elas são através de uma escolha extremamente simples, a saber: ser antítese fiel de todas essas malignidades, fazendo com que nossos algozes nos enxerguem como seres de pensamentos antagônicos.

Automaticamente, isso fará os vizinhos perceberem o raio de sabedoria que nos separa desses estultos e isso nos deixará com uma credibilidade maior no ambiente externo e por ilação, fará o vigor adversário ser afetado, sofrendo uma ruptura natural que fará sua base ser menos rígida e mais flexível.

Quando isso acontecer, teremos mais facilidade para caminhar, tendo em conta que o espaço terá ficado mais amplo e as estradas mais fáceis de serem vislumbradas, o que ocasionará em uma viagem mais tranquila e segura.

Destarte, poderemos acelerar e chegar ao nosso destino mais rapidamente, pois não teremos que nos preocupar com pedras, buracos no asfalto e quaisquer outra barreira que possa nos atrasar ou até mesmo nos causar algum acidente no percurso.

Leia também:  Como Saber Qual Oleo Usar No Motor?

E com a mente livre dessas cercas refratárias, aumentaremos nossas chances de êxito e alcançaremos nossas vitórias de uma forma mais amena, ou seja, sem comprometer em demasia nossas qualidades emocionais. Sem dúvidas, essa será uma etapa que nos trará não só um grande reconhecimento por parte de nossos semelhantes, mas um enorme regozijo para os nossos corações.

Concluindo afirmo que ninguém tem autoridade para tirar sua paz interior e também sua alegria de viver, porquanto as forças superiores jamais permitiriam que um ser vivo viesse para a Terra sem ter o direito de ser feliz.

Assim, que possamos compreender que são as nossas escolhas presentes que influenciaram o nosso passado e influenciarão o nosso futuro, e que o nosso desenho pode ser colorido ou preto e branco, dependendo da capacidade artística e da fé de cada escultor aqui existente.

O mau hábito de se sentir ofendido com tudo

Todos nós conhecemos alguém que costuma se sentir ofendido com tudo. É muito difícil lidar com esse tipo de pessoa, já que a qualquer momento elas podem ficar aborrecidas com algo que nunca passou pela nossa cabeça que poderia incomodá-las.

O complicado é que muitas vezes se sentem incomodadas ou desconfortáveis com fatos ou situações que realmente não valem a pena.

Seja por uma piada insignificante, um pequeno esquecimento ou pelo uso de uma palavra que elas acham intolerável.

Às vezes, o que existe é um estado de extrema suscetibilidade, ou então simplesmente assumiram o hábito de se sentirem ofendidas por tudo.

“Quem não conhece o riso é suscetível a conhecer a dor, e isso é ainda mais complexo”.
– Javier Marías –

Tanto para aqueles que se sentem assim, quanto para as pessoas que os rodeiam, tudo se torna muito difícil. Essa atitude acaba bloqueando o relacionamento com os outros, além de gerar muito sofrimento, quase sempre de forma desnecessária. Por que há pessoas que se ofendem com tudo? O que fazer nesses casos?

As razões para se sentir ofendido com tudo

Essa sensação de ofensa ocorre quando percebemos que os outros nos tratam com depreciação e inferioridade, quando não nos reconhecem ou não reconhecem o que fazemos. Certamente isso ofende, mas sejamos sinceros, acontece todos os dias.

No entanto, para algumas pessoas, esse tipo de situação é intolerável. Elas são radicais e sofrem com isso. O fato de alguém se sentir ofendido com tudo pode ter várias causas. Estas são algumas delas:

  • Sentimento de inferioridade. Quando a autoestima não é sólida e há um ego forte, é possível que a pessoa se sinta ofendida com tudo. Acredita que os outros gostariam de lembrá-la constantemente de que ela é inferior. No entanto, é o seu complexo que a faz se sentir assim.
  • Pensamento rígido. São pessoas que acreditam que as coisas devem ser ditas ou feitas de uma única maneira. Quando algo não atende a esses parâmetros, sentem que a ordem foi quebrada e se ofendem. Além disso, geralmente são muito suscetíveis a críticas contra as suas crenças.
  • Egocentrismo. Dar muita importância ao “eu sou” nos deixa um pouco paranoicos. Acabamos assumindo que tudo gira ao nosso redor e que os outros estão sempre comentando, olhando ou apontando a nossa maneira de ser ou agir.

É aconselhável ter cuidado ao lidar com questões como religião, sexualidade, ideologias políticas ou nacionalismos. São temas que despertam todo tipo de suscetibilidade, mais ainda para alguém que se sente ofendido com tudo.

As ofensas e sua verdadeira importância

Muitas pessoas dizem: “Ninguém o ofende. É você quem se ofende com tudo”. E isso realmente é verdade. Todos têm o direito de pensar, opinar e dizer o que desejam. Mas, é claro que existe um limite.

A violência psicológica é inadmissível. Entre a violência psicológica e uma opinião ou atitude que não gostamos, há um longo caminho a percorrer. Ninguém pode viver de forma saudável e se sentir ofendido com tudo a todo momento.

O que podemos fazer? Essas recomendações podem ajudar alguém que se ofende tudo:

  • Ninguém o ofendeu, o outro simplesmente tem ideias diferentes das suas. Talvez você acredite que ele deva pensar ou agir de uma determinada maneira. O que está errado são as suas expectativas, não o que os outros fazem ou dizem.
  • Permitir que as pessoas sejam do jeito que são. Ninguém tem o direito de moldar o comportamento da outra pessoa. Entenda que devemos aceitar os outros como eles são, bem como exigir que eles nos aceitem como somos.
  • Nenhum comentário casual vai mudar a sua vida. As pessoas podem falar bem ou mal de você, mas nem um e nem outro vai mudar a sua vida. O que importa é como você se vê e como se sente em relação a si mesmo.
  • Aprenda a rir de si mesmo. Não se leve tão a sério. A única coisa que você consegue com isso é ficar “chateado” e extremamente suscetível a qualquer coisa que afete o seu ego. Agir dessa forma só prejudica você mesmo e afasta os outros.

É importante que aprendamos a ser cuidadosos em relação ​​aos comentários ou atitudes dos outros. Sentir-se ofendido com tudo só nos leva a estar em permanente conflito com os outros, na maioria das vezes por questões sem importância alguma.

Filósofo dá quatro dicas para reagir bem ao ser contrariado

Para a maioria das pessoas, é extremamente difícil a experiência de ser contrariado. Apesar disto, de saber que praticamente ninguém gosta de ser contrariado, a contrariedade também tem o seu lado positivo e pode ser pedagógica: ensinar que não somos soberanos e que nem tudo tem de se dobrar diante de nossa “magnífica” vontade.  

Quanto a isto, o filósofo Fabiano de Abreuacredita que quando somos contrariados temos a possibilidade de descobrir verdades e crescer emocionalmente.

“Algumas pessoas possuem uma grande dificuldade em aceitar opiniões diferentes, não admitem serem contrariadas e se ofendem quando suas ideias não são aceitas.

A essas pessoas, falta humildade intelectual, que está relacionada ao fato de saber ouvir o NÃO, uma palavra negativa, que é a chave para um conhecimento que trará coisas positivas”. 

  • Para ajudar você a reagir da melhor maneira possível ao ser contrariado e assim conseguir obter os benefícios da diversidade de idéias, Fabiano enumera 4 dicas que não apenas vão lhe dar uma orientação para reagir bem diante de críticas e negativas, mas ensinar a extrair valiosos aprendizados. 
  • 1- Quando somos confrontados, a ofensa é opcional  
  • Para aprender a ouvir uma negativa, ou uma contraposta a ideia que, a princípio, achávamos genial, devemos nos manter abertos e ter humildade para receber novos conhecimentos.

Quando nos permitimos ouvir as opiniões contrárias, sem nos ofender com o que nos foi dito e crescer emocionalmente. Isto é necessário para que possamos avaliar as nossas ideias e objetivos. Assim seremos mais abertos e modestos na vida, sem a infantil pretensão de acreditar que nossa visão e posição devem ser sempre únicas e absolutas. 

2- Pare de impôr as suas ideias. Seja mais humilde 

Não saber ser contrariado afeta problematicamente pontos cruciais da nossa vida, no pessoal e no profissional. No ambiente de trabalho, se a pessoa é uma funcionária e não sabe lidar com críticas e demandas, ela com certeza passará a ser mal vista pelos colegas.

Dentro de um relacionamento afetivo e/ou amoroso, seja em um casamento, namoro ou amizade, a pessoa que não aceita ser contrariada vive impondo suas vontades, e geralmente escolhe parceiros inibidos, fracos e submissos, até para não terem que bater de frente e em um dado momento precisarem ceder. Isto é muito mal. 

Quem não sabe ouvir opiniões perde muitas oportunidades de aprender com os colegas, e até com os seus superiores, por acreditar que as suas ideias sempre são melhores do que as das outras pessoas.

E mesmo quando precisa ceder, por uma força maior, porque o chefe mandou, ela fica revoltada e “meio que” torce o nariz para a ideia aprovada, como se fosse torcer para ela dar errado, só para depois poder dizer: “Eu avisei”. 

Aprenda a ter humildade intelectual. O hábito constante de impôr e sobrepor a sua ideia às dos outros é considerado repugnante por muitos e te afasta das pessoas, tanto no ambiente de trabalho como na vida. 

Seu orgulho não te levará e nem nunca te levou a nada. Tenha humildade e aprenda a escutar. Una isso a boa vontade, e todos perceberão que a convivência com você se tornou mais agradável. Você só tem a ganhar com isso. 

3- Ouça mais para errar menos

O problema maior em uma pessoa que não aceita ser contrariada é que ela constantemente comete erros como resultado da ignorância, de ignorar o que o outro diz, ou por excesso de autoconfiança. Contudo, para justificar os seus fracassos, ela coloca a culpa nos outros, justamente porque não admite falhas e porque também não escuta as pessoas. 

É importante ouvir mais para errar menos. Sabemos que devemos aprender com as falhas para crescer. Que não há vitória, sem derrota e que é com a experiência que alcançamos o sucesso. Mas a pessoa que não admite ser contrariada, finge não saber disso. 

4- Use a razão para a auto-avaliação antes de dar lugar às emoções 

Pare e pense: Se estão te contrariando algum motivo existe. Ou você está errado e deve parar e analisar suas atitudes, ou o outro está errado. Mas você só saberá isso, se você se abrir e escutar. Parar e refletir sobre tudo que foi dito. 

Se permita discutir e expor os seus pontos de vistas, mas respeite também os pontos de vistas dos outros de forma lógica, racional e paciente.  

Não é fácil mas faz parte de crescer, é necessário. Atitudes imaturas e intransigentes causam muitos danos. Por isso, aceite que está na hora de ser mais maleável.

Seja o primeiro a comentar

Faça um comentário

Seu e-mail não será publicado.
